![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Trypanosoma cruzi [TaxId:5693] [196511] (20 PDB entries) |
![]() | Domain d6fmod_: 6fmo D: [359250] automated match to d4uhia_ complexed with dve, hem; mutant |
PDB Entry: 6fmo (more details), 3.18 Å
SCOPe Domain Sequences for d6fmod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fmod_ a.104.1.0 (D:) automated matches {Trypanosoma cruzi [TaxId: 5693]} lppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrff sprneilsprevytfmtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhev rkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslip aavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkavy rdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaql nydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhd eeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrd evpdpdyhtmvvgptlnqclvkytrkkk
Timeline for d6fmod_: