Lineage for d6flag_ (6fla G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375406Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2375450Protein automated matches [190183] (10 species)
    not a true protein
  7. 2375456Species Dengue virus 2 [TaxId:11060] [359240] (2 PDB entries)
  8. 2375459Domain d6flag_: 6fla G: [359246]
    Other proteins in same PDB: d6flab1, d6flab2, d6flai_, d6flal1, d6flal2
    automated match to d3uzva_
    complexed with cl, gol

Details for d6flag_

PDB Entry: 6fla (more details), 2.9 Å

PDB Description: 3h5 fab bound to ediii of denv 2 xtal form 1
PDB Compounds: (G:) Domain III of Dengue virus 2

SCOPe Domain Sequences for d6flag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6flag_ b.1.18.4 (G:) automated matches {Dengue virus 2 [TaxId: 11060]}
msysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnp
ivtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

SCOPe Domain Coordinates for d6flag_:

Click to download the PDB-style file with coordinates for d6flag_.
(The format of our PDB-style files is described here.)

Timeline for d6flag_: