![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
![]() | Protein automated matches [190183] (10 species) not a true protein |
![]() | Species Dengue virus 2 [TaxId:11060] [359240] (2 PDB entries) |
![]() | Domain d6flag_: 6fla G: [359246] Other proteins in same PDB: d6flab1, d6flab2, d6flai_, d6flal1, d6flal2 automated match to d3uzva_ complexed with cl, gol |
PDB Entry: 6fla (more details), 2.9 Å
SCOPe Domain Sequences for d6flag_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6flag_ b.1.18.4 (G:) automated matches {Dengue virus 2 [TaxId: 11060]} msysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnp ivtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
Timeline for d6flag_: