SCOPe 2.07: Domain d6flbl2: 6flb L:112-216

Lineage for d6flbl2 (6flb L:112-216)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d6flbl2: 6flb L:112-216 [359245]
   Other proteins in same PDB: d6flbg_, d6flbl1
   automated match to d1tqbc2
   complexed with cl, gol, po4

Details for d6flbl2

PDB Entry: 6flb, 2.2 Å

PDB Description: 3h5 fab bound to ediii of denv 2 xtal form 2

PDB Compounds: (L:) Light chain of 3H5 Fab

SCOPe Domain Sequences for d6flbl2:

Sequence; same for both SEQRES and ATOM records:

>d6flbl2 b.1.1.2 (L:112-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d6flbl2:

• d6flbl2 is new in SCOPe 2.07-stable
  
• d6flbl2 appears in the current release, SCOPe 2.08