Lineage for d6enpa_ (6enp A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535185Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2535186Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2535825Family d.5.1.0: automated matches [191478] (1 protein)
    not a true family
  6. 2535826Protein automated matches [190767] (7 species)
    not a true protein
  7. 2535835Species Human (Homo sapiens) [TaxId:9606] [255211] (6 PDB entries)
  8. 2535836Domain d6enpa_: 6enp A: [359235]
    automated match to d4x09a_
    complexed with cl, na, po4, zn

Details for d6enpa_

PDB Entry: 6enp (more details), 1.04 Å

PDB Description: atomic resolution structure of human rnase 6 in the presence of phosphate anions in p21 space group.
PDB Compounds: (A:) Ribonuclease K6

SCOPe Domain Sequences for d6enpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6enpa_ d.5.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mwpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdlls
ivcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklv
pvhldsil

SCOPe Domain Coordinates for d6enpa_:

Click to download the PDB-style file with coordinates for d6enpa_.
(The format of our PDB-style files is described here.)

Timeline for d6enpa_:

  • d6enpa_ is new in SCOPe 2.07-stable
  • d6enpa_ appears in the current release, SCOPe 2.08, called d6enpa1