Lineage for d1dluc2 (1dlu C:269-392)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392125Family c.95.1.1: Thiolase-related [53902] (9 proteins)
  6. 1392407Protein Biosynthetic thiolase [53905] (1 species)
  7. 1392408Species Zoogloea ramigera [TaxId:350] [53906] (16 PDB entries)
    Uniprot P07097
  8. 1392518Domain d1dluc2: 1dlu C:269-392 [35921]
    complexed with mpd, so4

Details for d1dluc2

PDB Entry: 1dlu (more details), 2.25 Å

PDB Description: unliganded biosynthetic thiolase from zoogloea ramigera
PDB Compounds: (C:) biosynthetic thiolase

SCOPe Domain Sequences for d1dluc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dluc2 c.95.1.1 (C:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOPe Domain Coordinates for d1dluc2:

Click to download the PDB-style file with coordinates for d1dluc2.
(The format of our PDB-style files is described here.)

Timeline for d1dluc2: