SCOPe 2.08: Domain d1dluc1: 1dlu C:4-268

Lineage for d1dluc1 (1dlu C:4-268)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Biosynthetic thiolase, N-terminal domain [419020] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [419502] (16 PDB entries)
   Uniprot P07097

8. Domain d1dluc1: 1dlu C:4-268 [35920]
   Other proteins in same PDB: d1dlua2, d1dlub2, d1dluc2, d1dlud2
   complexed with mpd, so4
   has additional insertions and/or extensions that are not grouped together

Details for d1dluc1

PDB Entry: 1dlu, 2.25 Å

PDB Description: unliganded biosynthetic thiolase from zoogloea ramigera

PDB Compounds: (C:) biosynthetic thiolase

SCOPe Domain Sequences for d1dluc1:

Sequence; same for both SEQRES and ATOM records:

>d1dluc1 c.95.1.1 (C:4-268) Biosynthetic thiolase, N-terminal domain {Zoogloea ramigera [TaxId: 350]}
siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
gnasglndgaaaallmseaeasrrg

Timeline for d1dluc1:

• d1dluc1 first appeared (with stable ids) in SCOP 1.55
  
• d1dluc1 appears in SCOPe 2.07