SCOPe 2.07: Domain d6ctca2: 6ctc A:338-679

Lineage for d6ctca2 (6ctc A:338-679)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)

8. Domain d6ctca2: 6ctc A:338-679 [359194]
   automated match to d4h0wa2
   complexed with co3, fe, pop

Details for d6ctca2

PDB Entry: 6ctc, 2.6 Å

PDB Description: crystal structure of human transferrin bound to triferic fpc iron pyrophosphate

PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d6ctca2:

Sequence; same for both SEQRES and ATOM records:

>d6ctca2 c.94.1.0 (A:338-679) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eckpvkwcalshherlkcdewsvnsvgkiecvsaettedciakimngeadamsldggfvy
iagkcglvpvlaenynksdncedtpeagyfaiavvkksasdltwdnlkgkkschtavgrt
agwnipmgllynkinhcrfdeffsegcapgskkdsslcklcmgsglnlcepnnkegyygy
tgafrclvekgdvafvkhqtvpqntggknpdpwaknlnekdyellcldgtrkpveeyanc
hlarapnhavvtrkdkeacvhkilrqqqhlfgsnvtdcsgnfclfrsetkdllfrddtvc
laklhdrntyekylgeeyvkavgnlrkcstsslleactfrrp

Timeline for d6ctca2:

• d6ctca2 is new in SCOPe 2.07-stable
  
• d6ctca2 appears in the current release, SCOPe 2.08