Lineage for d6bvia_ (6bvi A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein cH-p21 Ras protein [52593] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [52594] (157 PDB entries)
    Uniprot Q6P716
  8. Domain d6bvia_: 6bvi A: [359155]
    Other proteins in same PDB: d6bvib1, d6bvib2, d6bvic2
    automated match to d1nvvq_
    complexed with ec4, fmt, gnp, gol, mg, na

Details for d6bvia_

PDB Entry: 6bvi (more details), 1.7500000000000002 Å

PDB Description: ras:sos:ras in complex with a small molecule activator
PDB Compounds: (A:) gtpase hras

SCOPe Domain Sequences for d6bvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bvia_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeasamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d6bvia_ are not available.

Timeline for d6bvia_:

Domains from other chains:
(mouse over for more information)
d6bvib1, d6bvib2, d6bvic1, d6bvic2