SCOPe 2.08: Domain d1qfld1: 1qfl D:4-268

Lineage for d1qfld1 (1qfl D:4-268)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Biosynthetic thiolase, N-terminal domain [419020] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [419502] (16 PDB entries)
   Uniprot P07097

8. Domain d1qfld1: 1qfl D:4-268 [35914]
   Other proteins in same PDB: d1qfla2, d1qflb2, d1qflc2, d1qfld2
   complexed with coa, so4
   has additional insertions and/or extensions that are not grouped together

Details for d1qfld1

PDB Entry: 1qfl, 1.92 Å

PDB Description: biosynthetic thiolase from zoogloea ramigera in complex with a reaction intermediate.

PDB Compounds: (D:) protein (acetoacetyl-coa thiolase)

SCOPe Domain Sequences for d1qfld1:

Sequence; same for both SEQRES and ATOM records:

>d1qfld1 c.95.1.1 (D:4-268) Biosynthetic thiolase, N-terminal domain {Zoogloea ramigera [TaxId: 350]}
siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
gnasglndgaaaallmseaeasrrg

Timeline for d1qfld1:

• d1qfld1 first appeared (with stable ids) in SCOP 1.55
  
• d1qfld1 appears in SCOPe 2.07