Lineage for d6a7pb3 (6a7p B:389-568)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. Species Human (Homo sapiens) [TaxId:9606] [48555] (93 PDB entries)
    Uniprot P02768 29-596
  8. Domain d6a7pb3: 6a7p B:389-568 [359119]
    automated match to d1n5ua3
    complexed with 9sc, k, pg4, po4

Details for d6a7pb3

PDB Entry: 6a7p (more details), 2.2800000000000002 Å

PDB Description: human serum albumin complexed with aripiprazole
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d6a7pb3:

Sequence, based on SEQRES records: (download)

>d6a7pb3 a.126.1.1 (B:389-568) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf

Sequence, based on observed residues (ATOM records): (download)

>d6a7pb3 a.126.1.1 (B:389-568) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddkcf

SCOPe Domain Coordinates for d6a7pb3 are not available.

Timeline for d6a7pb3:

View in 3D
Domains from same chain:
(mouse over for more information)
d6a7pb1, d6a7pb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6a7pa1, d6a7pa2, d6a7pa3