SCOPe 2.05: Domain d1qflb2: 1qfl B:269-392

Lineage for d1qflb2 (1qfl B:269-392)

Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.1: Thiolase-related [53902] (9 proteins)
Protein Biosynthetic thiolase [53905] (1 species)
Species Zoogloea ramigera [TaxId:350] [53906] (16 PDB entries)
Uniprot P07097
Domain d1qflb2: 1qfl B:269-392 [35911]
complexed with coa, so4

Details for d1qflb2

PDB Entry: 1qfl (more details), 1.92 Å

PDB Description: biosynthetic thiolase from zoogloea ramigera in complex with a reaction intermediate.

PDB Compounds: (B:) protein (acetoacetyl-coa thiolase)

SCOPe Domain Sequences for d1qflb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qflb2 c.95.1.1 (B:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOPe Domain Coordinates for d1qflb2:

Click to download the PDB-style file with coordinates for d1qflb2.
(The format of our PDB-style files is described here.)

Timeline for d1qflb2: