Lineage for d6btzd_ (6btz D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773076Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries)
  8. 2773096Domain d6btzd_: 6btz D: [359105]
    automated match to d1rh8a_
    complexed with gol, o4b, so4

Details for d6btzd_

PDB Entry: 6btz (more details), 1.85 Å

PDB Description: crystal structure of the pi3kc2alpha c2 domain in space group c121
PDB Compounds: (D:) Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha

SCOPe Domain Sequences for d6btzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6btzd_ b.7.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iggavklsisyrngtlfimvmhikdlvtedgadpnpyvktyllpdnhktskrktkisrkt
rnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggvtlplkdfnlsketvkwy
qltaat

SCOPe Domain Coordinates for d6btzd_:

Click to download the PDB-style file with coordinates for d6btzd_.
(The format of our PDB-style files is described here.)

Timeline for d6btzd_: