SCOPe 2.08: Domain d6hrla_: 6hrl A:

Lineage for d6hrla_ (6hrl A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.11: Kelch motif [117281] (2 families)

5. Family b.68.11.0: automated matches [191536] (1 protein)
   not a true family

6. Protein automated matches [190912] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188385] (6 PDB entries)

8. Domain d6hrla_: 6hrl A: [359097]
   automated match to d2xn4a_
   complexed with cl, edo, na, so4

Details for d6hrla_

PDB Entry: 6hrl, 2.6 Å

PDB Description: crystal structure of the kelch domain of human klhl17

PDB Compounds: (A:) Kelch-like protein 17

SCOPe Domain Sequences for d6hrla_:

Sequence; same for both SEQRES and ATOM records:

>d6hrla_ b.68.11.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gagpvlfavgggslfaihgdceaydtrtdrwhvvasmstrrarvgvaavgnrlyavggyd
gtsdlatvesydpvtntwqpevsmgtrrsclgvaalhgllysaggydgasclnsaerydp
ltgtwtsvaamstrrryvrvatldgnlyavggydssshlatvekyepqvnvwspvasmls
rrssagvavlegalyvaggndgtsclnsveryspkagawesvapmnirrsthdlvamdgw
lyavggndgssslnsiekynprtnkwvaascmftrrssvgvavlell

Timeline for d6hrla_:

• d6hrla_ first appeared in SCOPe 2.07