Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.189: PX domain [64267] (1 superfamily) beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch |
Superfamily d.189.1: PX domain [64268] (2 families) |
Family d.189.1.0: automated matches [191384] (1 protein) not a true family |
Protein automated matches [190483] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187420] (17 PDB entries) |
Domain d6buba_: 6bub A: [359091] automated match to d2iwlx_ complexed with gol, so4 |
PDB Entry: 6bub (more details), 2.6 Å
SCOPe Domain Sequences for d6buba_:
Sequence, based on SEQRES records: (download)
>d6buba_ d.189.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} epilsfspktysfrqdgrikevsvftyhkkynpdkhyiyvvrilregqiepsfvfrtfde fqelhnklsiifplwklpgfpnrmvlgrthikdvaakrkielnsylqslmnastdvaecd lvctffhpllrdek
>d6buba_ d.189.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} epilsfspktysfrqdgrikevsvftyhkkynpdkhyiyvvrilregqiepsfvfrtfde fqelhnklsiifplwklpgfpndvaakrkielnsylqslmnastdvaecdlvctffhpll rdek
Timeline for d6buba_: