Lineage for d6buba_ (6bub A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005656Fold d.189: PX domain [64267] (1 superfamily)
    beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch
  4. 3005657Superfamily d.189.1: PX domain [64268] (2 families) (S)
  5. 3005685Family d.189.1.0: automated matches [191384] (1 protein)
    not a true family
  6. 3005686Protein automated matches [190483] (1 species)
    not a true protein
  7. 3005687Species Human (Homo sapiens) [TaxId:9606] [187420] (17 PDB entries)
  8. 3005711Domain d6buba_: 6bub A: [359091]
    automated match to d2iwlx_
    complexed with gol, so4

Details for d6buba_

PDB Entry: 6bub (more details), 2.6 Å

PDB Description: crystal structure of the pi3kc2alpha px domain in space group p432
PDB Compounds: (A:) Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha

SCOPe Domain Sequences for d6buba_:

Sequence, based on SEQRES records: (download)

>d6buba_ d.189.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epilsfspktysfrqdgrikevsvftyhkkynpdkhyiyvvrilregqiepsfvfrtfde
fqelhnklsiifplwklpgfpnrmvlgrthikdvaakrkielnsylqslmnastdvaecd
lvctffhpllrdek

Sequence, based on observed residues (ATOM records): (download)

>d6buba_ d.189.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epilsfspktysfrqdgrikevsvftyhkkynpdkhyiyvvrilregqiepsfvfrtfde
fqelhnklsiifplwklpgfpndvaakrkielnsylqslmnastdvaecdlvctffhpll
rdek

SCOPe Domain Coordinates for d6buba_:

Click to download the PDB-style file with coordinates for d6buba_.
(The format of our PDB-style files is described here.)

Timeline for d6buba_: