SCOPe 2.07: Domain d6dj7b_: 6dj7 B:

Lineage for d6dj7b_ (6dj7 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)

8. Domain d6dj7b_: 6dj7 B: [359085]
   automated match to d3vf7a_
   complexed with act, cl, g10, gol, na; mutant

Details for d6dj7b_

PDB Entry: 6dj7, 1.31 Å

PDB Description: hiv-1 protease with mutation l76v in complex with grl-5010 (gem- difluoro-bis-tetrahydrofuran as p2 ligand)

PDB Compounds: (B:) hiv-1 protease

SCOPe Domain Sequences for d6dj7b_:

Sequence; same for both SEQRES and ATOM records:

>d6dj7b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvvvgptpvniigrnlltqigatlnf

Timeline for d6dj7b_:

• d6dj7b_ is new in SCOPe 2.07-stable
  
• d6dj7b_ appears in the current release, SCOPe 2.08