Lineage for d5ys5a1 (5ys5 A:31-170)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771427Protein multi-copper oxidase CueO, N- and middle domain [418908] (1 species)
  7. 2771428Species Escherichia coli [TaxId:562] [419322] (38 PDB entries)
  8. 2771503Domain d5ys5a1: 5ys5 A:31-170 [359077]
    Other proteins in same PDB: d5ys5a3
    automated match to d1kv7a1
    complexed with cu; mutant

Details for d5ys5a1

PDB Entry: 5ys5 (more details), 2.2 Å

PDB Description: crystal structure of multicopper oxidase cueo g304k mutant with seven copper ions
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d5ys5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ys5a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO, N- and middle domain {Escherichia coli [TaxId: 562]}
rptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvdi
ynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktgr
qvamglaglvvieddeilkl

SCOPe Domain Coordinates for d5ys5a1:

Click to download the PDB-style file with coordinates for d5ys5a1.
(The format of our PDB-style files is described here.)

Timeline for d5ys5a1: