Lineage for d5zokc1 (5zok C:266-462)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. Protein automated matches [191125] (8 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [189203] (4 PDB entries)
  8. Domain d5zokc1: 5zok C:266-462 [359070]
    Other proteins in same PDB: d5zoka2, d5zokc2
    automated match to d3gmja_
    protein/DNA complex

Details for d5zokc1

PDB Entry: 5zok (more details), 2.8499999999999996 Å

PDB Description: crystal structure of human smad1-man1 complex.
PDB Compounds: (C:) Mothers against decapentaplegic homolog 1

SCOPe Domain Sequences for d5zokc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zokc1 b.26.1.0 (C:266-462) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eepkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstien
trrhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnn
qefaqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplq
wldkvltqmgsphnpis

SCOPe Domain Coordinates for d5zokc1 are not available.

Timeline for d5zokc1:

Domains from same chain:
(mouse over for more information)
d5zokc2
Domains from other chains:
(mouse over for more information)
d5zoka1, d5zoka2