| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.1: Thiolase-related [53902] (10 proteins) |
| Protein Thiolase [53903] (1 species) topology of each domain is similar to the first domain of phosphoglucomutase |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries) |
| Domain d1pxta2: 1pxt A:294-417 [35905] |
PDB Entry: 1pxt (more details), 2.8 Å
SCOPe Domain Sequences for d1pxta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pxta2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnlpvlgryidfqtvgvppeimgvgpayaipkvleatglqvqdidifeineafaaqalyc
ihklgidlnkvnprggaialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaai
fike
Timeline for d1pxta2: