SCOPe 2.08: Domain d1pxta2: 1pxt A:294-417

Lineage for d1pxta2 (1pxt A:294-417)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Thiolase, C-terminal domain [419027] (1 species)
   topology is similar to the first domain of phosphoglucomutase
7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419509] (2 PDB entries)

8. Domain d1pxta2: 1pxt A:294-417 [35905]
   Other proteins in same PDB: d1pxta1, d1pxtb1

Details for d1pxta2

PDB Entry: 1pxt, 2.8 Å

PDB Description: the 2.8 angstroms structure of peroxisomal 3-ketoacyl-coa thiolase of saccharomyces cerevisiae: a five layered a-b-a-b-a structure, constructed from two core domains of identical topology

PDB Compounds: (A:) peroxisomal 3-ketoacyl-coa thiolase

SCOPe Domain Sequences for d1pxta2:

Sequence; same for both SEQRES and ATOM records:

>d1pxta2 c.95.1.1 (A:294-417) Thiolase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnlpvlgryidfqtvgvppeimgvgpayaipkvleatglqvqdidifeineafaaqalyc
ihklgidlnkvnprggaialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaai
fike

Timeline for d1pxta2:

• d1pxta2 first appeared (with stable ids) in SCOP 1.55
  
• d1pxta2 appears in SCOPe 2.07