SCOPe 2.08: Domain d6ml8l2: 6ml8 L:107-212

Lineage for d6ml8l2 (6ml8 L:107-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6ml8l2: 6ml8 L:107-212 [359049]
   Other proteins in same PDB: d6ml8a_, d6ml8b_, d6ml8h_, d6ml8l1
   automated match to d1dn0a2

Details for d6ml8l2

PDB Entry: 6ml8, 2.92 Å

PDB Description: crystal structure of hemagglutinin from h1n1 influenza a virus a/denver/57 bound to the c05 antibody

PDB Compounds: (L:) C05 antibody Fab light chain

SCOPe Domain Sequences for d6ml8l2:

Sequence; same for both SEQRES and ATOM records:

>d6ml8l2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d6ml8l2:

• d6ml8l2 first appeared in SCOPe 2.07