Lineage for d6mpya1 (6mpy A:36-440)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720708Species Burkholderia pseudomallei [TaxId:28450] [350213] (4 PDB entries)
  8. 2720717Domain d6mpya1: 6mpy A:36-440 [359034]
    automated match to d2ccda1
    complexed with cl, hem, mpd, na, oxy, po4

Details for d6mpya1

PDB Entry: 6mpy (more details), 2 Å

PDB Description: b. pseudomallei katg crystallized in the presence of benzoyl hydrazide
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d6mpya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mpya1 a.93.1.0 (A:36-440) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
payekisrrfhenpeqfadafarawfklthrdmgprarylgpevp

SCOPe Domain Coordinates for d6mpya1:

Click to download the PDB-style file with coordinates for d6mpya1.
(The format of our PDB-style files is described here.)

Timeline for d6mpya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6mpya2