| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
| Family c.95.1.1: Thiolase-related [53902] (7 proteins) |
| Protein Thiolase [53903] (1 species) topology of each domain is similar to the first domain of phosphoglucomutase |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries) |
| Domain d1afwb2: 1afw B:294-417 [35903] |
PDB Entry: 1afw (more details), 1.8 Å
SCOP Domain Sequences for d1afwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afwb2 c.95.1.1 (B:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae)}
lnlpvlgryidfqtvgvppeimgvgpayaipkvleatglqvqdidifeineafaaqalyc
ihklgidlnkvnprggaialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaai
fike
Timeline for d1afwb2: