Lineage for d1afwb2 (1afw B:294-417)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128395Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 128396Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 128397Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 128514Protein Thiolase [53903] (1 species)
  7. 128515Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries)
  8. 128519Domain d1afwb2: 1afw B:294-417 [35903]

Details for d1afwb2

PDB Entry: 1afw (more details), 1.8 Å

PDB Description: the 1.8 angstrom crystal structure of the dimeric peroxisomal thiolase of saccharomyces cerevisiae

SCOP Domain Sequences for d1afwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afwb2 c.95.1.1 (B:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae)}
lnlpvlgryidfqtvgvppeimgvgpayaipkvleatglqvqdidifeineafaaqalyc
ihklgidlnkvnprggaialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaai
fike

SCOP Domain Coordinates for d1afwb2:

Click to download the PDB-style file with coordinates for d1afwb2.
(The format of our PDB-style files is described here.)

Timeline for d1afwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1afwb1