Lineage for d6fz7a1 (6fz7 A:4-389)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. Protein automated matches [190277] (12 species)
    not a true protein
  7. Species Geobacillus stearothermophilus [TaxId:1422] [226739] (12 PDB entries)
  8. Domain d6fz7a1: 6fz7 A:4-389 [359029]
    Other proteins in same PDB: d6fz7a2
    automated match to d4fkba_
    complexed with ca, zn

Details for d6fz7a1

PDB Entry: 6fz7 (more details), 1.7400000000000002 Å

PDB Description: crystal structure of lipase from geobacillus stearothermophilus t6 methanol stable variant l184f
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d6fz7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fz7a1 c.69.1.18 (A:4-389) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
srandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdr
aceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarml
vsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffd
fqkavlkaaavasnvpytsqvydfkldqwglrrqpgesfdqyferlkrspvwtstdtary
dlsvpgaeklnqwvkaspntyylsfatertyrgaltgnyypelgmnafsavvcapflgsy
rnatlgiddrwlendgivnafsmngpkrgstdrivpydgtikkgvwndmgtynvdhlevi
gvdpnplfdirafylrlaeqlaslqp

SCOPe Domain Coordinates for d6fz7a1 are not available.

Timeline for d6fz7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fz7a2