Lineage for d1afwb1 (1afw B:25-293)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 28453Protein Thiolase [53903] (1 species)
  7. 28454Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries)
  8. 28457Domain d1afwb1: 1afw B:25-293 [35902]

Details for d1afwb1

PDB Entry: 1afw (more details), 1.8 Å

PDB Description: the 1.8 angstrom crystal structure of the dimeric peroxisomal thiolase of saccharomyces cerevisiae

SCOP Domain Sequences for d1afwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afwb1 c.95.1.1 (B:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae)}
knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl
ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi
diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq
defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikd
rgtttagnasqvsdgvagvllarrsvanq

SCOP Domain Coordinates for d1afwb1:

Click to download the PDB-style file with coordinates for d1afwb1.
(The format of our PDB-style files is described here.)

Timeline for d1afwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1afwb2