Lineage for d1afwb1 (1afw B:25-293)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916920Protein Thiolase, N-terminal domain [419026] (1 species)
    topology is similar to the first domain of phosphoglucomutase
  7. 2916921Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419508] (2 PDB entries)
  8. 2916923Domain d1afwb1: 1afw B:25-293 [35902]
    Other proteins in same PDB: d1afwa2, d1afwb2
    complexed with mrd
    has additional insertions and/or extensions that are not grouped together

Details for d1afwb1

PDB Entry: 1afw (more details), 1.8 Å

PDB Description: the 1.8 angstrom crystal structure of the dimeric peroxisomal thiolase of saccharomyces cerevisiae
PDB Compounds: (B:) 3-ketoacetyl-coa thiolase

SCOPe Domain Sequences for d1afwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afwb1 c.95.1.1 (B:25-293) Thiolase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl
ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi
diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq
defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikd
rgtttagnasqvsdgvagvllarrsvanq

SCOPe Domain Coordinates for d1afwb1:

Click to download the PDB-style file with coordinates for d1afwb1.
(The format of our PDB-style files is described here.)

Timeline for d1afwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1afwb2