SCOPe 2.08: Domain d1afwb1: 1afw B:25-293

Lineage for d1afwb1 (1afw B:25-293)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Thiolase, N-terminal domain [419026] (1 species)
   topology is similar to the first domain of phosphoglucomutase

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419508] (2 PDB entries)

8. Domain d1afwb1: 1afw B:25-293 [35902]
   Other proteins in same PDB: d1afwa2, d1afwb2
   complexed with mrd
   has additional insertions and/or extensions that are not grouped together

Details for d1afwb1

PDB Entry: 1afw, 1.8 Å

PDB Description: the 1.8 angstrom crystal structure of the dimeric peroxisomal thiolase of saccharomyces cerevisiae

PDB Compounds: (B:) 3-ketoacetyl-coa thiolase

SCOPe Domain Sequences for d1afwb1:

Sequence; same for both SEQRES and ATOM records:

>d1afwb1 c.95.1.1 (B:25-293) Thiolase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl
ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi
diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq
defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikd
rgtttagnasqvsdgvagvllarrsvanq

Timeline for d1afwb1:

• d1afwb1 first appeared (with stable ids) in SCOP 1.55
  
• d1afwb1 appears in SCOPe 2.07