SCOPe 2.08: Domain d6c40d_: 6c40 D:

Lineage for d6c40d_ (6c40 D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (9 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [358854] (1 PDB entry)

8. Domain d6c40d_: 6c40 D: [359019]
   automated match to d1u0sy_
   complexed with cu

Details for d6c40d_

PDB Entry: 6c40, 2.7 Å

PDB Description: chey41pytyrd54k from thermotoga maritima

PDB Compounds: (D:) Chemotaxis protein cheY

SCOPe Domain Sequences for d6c40d_:

Sequence; same for both SEQRES and ATOM records:

>d6c40d_ c.23.1.1 (D:) automated matches {Thermotoga maritima [TaxId: 243274]}
gkrvlivddaafmrmmlkdiitkagyevageatngreavxkykelkpdivtmkitmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs

Timeline for d6c40d_:

• d6c40d_ first appeared in SCOPe 2.07