![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.18: Bacterial lipase [53570] (4 proteins) lack the first two strands of the common fold |
![]() | Protein automated matches [190277] (12 species) not a true protein |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [226739] (12 PDB entries) |
![]() | Domain d6fz9a1: 6fz9 A:4-389 [359014] Other proteins in same PDB: d6fz9a2 automated match to d4fkba_ complexed with ca, zn |
PDB Entry: 6fz9 (more details), 1.25 Å
SCOPe Domain Sequences for d6fz9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fz9a1 c.69.1.18 (A:4-389) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} srandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdr aceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarml vsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffd lqkfvlkaaavasnvpytsqvydfkldqwglrrqpgesfdqyferlkrspvwtstdtary dlsvpgaeklnqwvkaspntyylsfatertyrgaltgnyypelgmnafsavvcapflgsy rnatlgiddrwlendgivnafsmngpkrgstdrivpydgtikkgvwndmgtynvdhfevi gvdpnplfdirafylrlaeqlaslqp
Timeline for d6fz9a1: