| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
| Domain d6h7ld1: 6h7l D:6-120 [359012] Other proteins in same PDB: d6h7lc2, d6h7ld2, d6h7le1, d6h7le2, d6h7lf_ automated match to d5da4a_ complexed with 2cv, na, y00 |
PDB Entry: 6h7l (more details), 2.7 Å
SCOPe Domain Sequences for d6h7ld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h7ld1 b.1.1.1 (D:6-120) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgsifalnimgwyrqapgkqrelvaaihsggttnyansvkg
rftisrdnaantvylqmnslkpedtavyycnvkdfgaiiydydywgqgtqvtvss
Timeline for d6h7ld1: