SCOP 1.63: Domain d1afwa2: 1afw A:294-417

Lineage for d1afwa2 (1afw A:294-417)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudodyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (6 proteins)

6. Protein Thiolase [53903] (1 species)
   topology of each domain is similar to the first domain of phosphoglucomutase

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries)

8. Domain d1afwa2: 1afw A:294-417 [35901]

Details for d1afwa2

PDB Entry: 1afw, 1.8 Å

PDB Description: the 1.8 angstrom crystal structure of the dimeric peroxisomal thiolase of saccharomyces cerevisiae

SCOP Domain Sequences for d1afwa2:

Sequence; same for both SEQRES and ATOM records:

>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae)}
lnlpvlgryidfqtvgvppeimgvgpayaipkvleatglqvqdidifeineafaaqalyc
ihklgidlnkvnprggaialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaai
fike

Timeline for d1afwa2:

• d1afwa2 first appeared (with stable ids) in SCOP 1.55
  
• d1afwa2 appears in SCOP 1.61
  
• d1afwa2 appears in SCOP 1.65
  
• d1afwa2 appears in the current release, SCOPe 2.08