Lineage for d1afwa2 (1afw A:294-417)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 251049Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudodyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest
  4. 251050Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 251051Family c.95.1.1: Thiolase-related [53902] (6 proteins)
  6. 251228Protein Thiolase [53903] (1 species)
    topology of each domain is similar to the first domain of phosphoglucomutase
  7. 251229Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries)
  8. 251231Domain d1afwa2: 1afw A:294-417 [35901]

Details for d1afwa2

PDB Entry: 1afw (more details), 1.8 Å

PDB Description: the 1.8 angstrom crystal structure of the dimeric peroxisomal thiolase of saccharomyces cerevisiae

SCOP Domain Sequences for d1afwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae)}
lnlpvlgryidfqtvgvppeimgvgpayaipkvleatglqvqdidifeineafaaqalyc
ihklgidlnkvnprggaialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaai
fike

SCOP Domain Coordinates for d1afwa2:

Click to download the PDB-style file with coordinates for d1afwa2.
(The format of our PDB-style files is described here.)

Timeline for d1afwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1afwa1