SCOPe 2.07: Domain d6h7ne1: 6h7n E:3-108

Lineage for d6h7ne1 (6h7n E:3-108)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d6h7ne1: 6h7n E:3-108 [359001]
   Other proteins in same PDB: d6h7nc1, d6h7nc2, d6h7nd_, d6h7ne2
   automated match to d1f6mc_
   complexed with 2cv, fvk, na

Details for d6h7ne1

PDB Entry: 6h7n, 2.5 Å

PDB Description: activated turkey beta1 adrenoceptor with bound partial agonist xamoterol and nanobody nb6b9

PDB Compounds: (E:) Thioredoxin 1

SCOPe Domain Sequences for d6h7ne1:

Sequence; same for both SEQRES and ATOM records:

>d6h7ne1 c.47.1.1 (E:3-108) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewsgpskmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

Timeline for d6h7ne1:

• d6h7ne1 is new in SCOPe 2.07-stable
  
• d6h7ne1 appears in the current release, SCOPe 2.08