Lineage for d6gxfb_ (6gxf B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. Protein automated matches [190543] (128 species)
    not a true protein
  7. Species Rhodopseudomonas palustris [TaxId:258594] [329218] (38 PDB entries)
  8. Domain d6gxfb_: 6gxf B: [359000]
    automated match to d5k3ba_

Details for d6gxfb_

PDB Entry: 6gxf (more details), 1.8 Å

PDB Description: the hit-and-return system enables efficient time-resolved serial synchrotron crystallography: raddam1
PDB Compounds: (B:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d6gxfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gxfb_ c.69.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
pdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkvi
vadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlal
dspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkak
laswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkip
vpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsaa

SCOPe Domain Coordinates for d6gxfb_ are not available.

Timeline for d6gxfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6gxfa_