Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
Protein Thiolase, N-terminal domain [419026] (1 species) topology is similar to the first domain of phosphoglucomutase |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419508] (2 PDB entries) |
Domain d1afwa1: 1afw A:25-293 [35900] Other proteins in same PDB: d1afwa2, d1afwb2 complexed with mrd has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1afw (more details), 1.8 Å
SCOPe Domain Sequences for d1afwa1:
Sequence, based on SEQRES records: (download)
>d1afwa1 c.95.1.1 (A:25-293) Thiolase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikd rgtttagnasqvsdgvagvllarrsvanq
>d1afwa1 c.95.1.1 (A:25-293) Thiolase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafigt ttagnasqvsdgvagvllarrsvanq
Timeline for d1afwa1: