![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
![]() | Protein Thioredoxin [52835] (16 species) |
![]() | Species Escherichia coli [TaxId:562] [52836] (55 PDB entries) Uniprot P00274 ! Uniprot P00581 |
![]() | Domain d6h7me1: 6h7m E:3-108 [358996] Other proteins in same PDB: d6h7mc1, d6h7mc2, d6h7md1, d6h7md2, d6h7me2 automated match to d1f6mc_ complexed with 2cv, 68h, na |
PDB Entry: 6h7m (more details), 2.76 Å
SCOPe Domain Sequences for d6h7me1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h7me1 c.47.1.1 (E:3-108) Thioredoxin {Escherichia coli [TaxId: 562]} kiihltddsfdtdvlkadgailvdfwaewsgpskmiapildeiadeyqgkltvaklnidq npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
Timeline for d6h7me1: