Lineage for d6h7me1 (6h7m E:3-108)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876219Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 2876297Domain d6h7me1: 6h7m E:3-108 [358996]
    Other proteins in same PDB: d6h7mc1, d6h7mc2, d6h7md1, d6h7md2, d6h7me2
    automated match to d1f6mc_
    complexed with 2cv, 68h, na

Details for d6h7me1

PDB Entry: 6h7m (more details), 2.76 Å

PDB Description: activated turkey beta1 adrenoceptor with bound partial agonist salbutamol and nanobody nb6b9
PDB Compounds: (E:) Thioredoxin 1

SCOPe Domain Sequences for d6h7me1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h7me1 c.47.1.1 (E:3-108) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewsgpskmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d6h7me1:

Click to download the PDB-style file with coordinates for d6h7me1.
(The format of our PDB-style files is described here.)

Timeline for d6h7me1: