SCOPe 2.08: Domain d6dila_: 6dil A:

Lineage for d6dila_ (6dil A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)

8. Domain d6dila_: 6dil A: [358990]
   automated match to d3vf7a_
   complexed with act, cl, gol, na, tpv; mutant

Details for d6dila_

PDB Entry: 6dil, 1.48 Å

PDB Description: hiv-1 protease with single mutation l76v in complex with tipranavir

PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d6dila_:

Sequence; same for both SEQRES and ATOM records:

>d6dila_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvvvgptpvniigrnlltqigatlnf

Timeline for d6dila_:

• d6dila_ first appeared in SCOPe 2.07