SCOP 1.73: Domain d1btjb_: 1btj B:

Lineage for d1btjb_ (1btj B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (3 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Transferrin [53897] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53899] (17 PDB entries)

8. Domain d1btjb_: 1btj B: [35899]
   N-terminal lobe

Details for d1btjb_

PDB Entry: 1btj, 3.2 Å

PDB Description: human serum transferrin, recombinant n-terminal lobe, apo form, crystal form 2

PDB Compounds: (B:) protein (serum transferrin)

SCOP Domain Sequences for d1btjb_:

Sequence; same for both SEQRES and ATOM records:

>d1btjb_ c.94.1.2 (B:) Transferrin {Human (Homo sapiens) [TaxId: 9606]}
ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
kvpprmdakmylgyeyvtairnlregtcpeapt

Timeline for d1btjb_:

• d1btjb_ first appeared (with stable ids) in SCOP 1.55
  
• d1btjb_ appears in SCOP 1.71
  
• d1btjb_ appears in SCOP 1.75
  
• d1btjb_ appears in the current release, SCOPe 2.08