SCOPe 2.08: Domain d6h7lc1: 6h7l C:6-120

Lineage for d6h7lc1 (6h7l C:6-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d6h7lc1: 6h7l C:6-120 [358972]
   Other proteins in same PDB: d6h7lc2, d6h7ld2, d6h7le1, d6h7le2, d6h7lf_
   automated match to d5da4a_
   complexed with 2cv, na, y00

Details for d6h7lc1

PDB Entry: 6h7l, 2.7 Å

PDB Description: activated turkey beta1 adrenoceptor with bound partial agonist dobutamine and nanobody nb6b9

PDB Compounds: (C:) Camelid antibody fragment Nb6B9

SCOPe Domain Sequences for d6h7lc1:

Sequence; same for both SEQRES and ATOM records:

>d6h7lc1 b.1.1.1 (C:6-120) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgsifalnimgwyrqapgkqrelvaaihsggttnyansvkg
rftisrdnaantvylqmnslkpedtavyycnvkdfgaiiydydywgqgtqvtvss

Timeline for d6h7lc1:

• d6h7lc1 first appeared in SCOPe 2.07