Lineage for d6gdla_ (6gdl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710701Species Human (Homo sapiens) [TaxId:9606] [47517] (123 PDB entries)
    Uniprot P02593
  8. 2710915Domain d6gdla_: 6gdl A: [358970]
    automated match to d1sw8a_
    mutant

    fragment; missing more than one-third of the common structure and/or sequence

Details for d6gdla_

PDB Entry: 6gdl (more details)

PDB Description: calmodulin mutant - f141l apo-form unstructured c-domain
PDB Compounds: (A:) Calmodulin-1

SCOPe Domain Sequences for d6gdla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gdla_ a.39.1.5 (A:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpefltmmarkmkdt

SCOPe Domain Coordinates for d6gdla_:

Click to download the PDB-style file with coordinates for d6gdla_.
(The format of our PDB-style files is described here.)

Timeline for d6gdla_: