Lineage for d6giua_ (6giu A:)
- Root: SCOPe 2.08
Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) 
Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheetSuperfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) 
Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins) 
Protein Inositol monophosphatase [56663] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56664] (11 PDB entries) 
Domain d6giua_: 6giu A: [358966]
automated match to d1imaa_
complexed with gol, l69, mn
Details for d6giua_
PDB Entry: 6giu (more details), 1.39 Å
PDB Description: human impase with l-690330
PDB Compounds: (A:) inositol monophosphatase 1SCOPe Domain Sequences for d6giua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6giua_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]}
dpwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikeky
pshsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvv
yscvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmekl
fcipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggp
fdlmsrrviaannrilaeriakeiqviplqrdded
SCOPe Domain Coordinates for d6giua_:
Click to download the PDB-style file with coordinates for d6giua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6giua_:
- d6giua_ first appeared in SCOPe 2.07
View in 3D
