Lineage for d1dtga_ (1dtg A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1625963Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 1626062Protein Transferrin [53897] (3 species)
  7. 1626063Species Human (Homo sapiens) [TaxId:9606] [53899] (20 PDB entries)
  8. 1626080Domain d1dtga_: 1dtg A: [35896]
    N-terminal lobe
    complexed with co3, fe; mutant

Details for d1dtga_

PDB Entry: 1dtg (more details), 2.4 Å

PDB Description: human transferrin n-lobe mutant h249e
PDB Compounds: (A:) transferrin

SCOPe Domain Sequences for d1dtga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtga_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]}
ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
qyfgysgafkclkdgagdvafvkhstifenlankadrdnyellcldntrkpvdeykdchl
aqvpsetvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
kvpprmdakmylgyeyvtairnlregtcpea

SCOPe Domain Coordinates for d1dtga_:

Click to download the PDB-style file with coordinates for d1dtga_.
(The format of our PDB-style files is described here.)

Timeline for d1dtga_: