Lineage for d1bp5d_ (1bp5 D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75273Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 75274Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 75451Family c.94.1.2: Transferrin [53888] (3 proteins)
  6. 75515Protein Transferrin [53897] (2 species)
  7. 75516Species Human (Homo sapiens) [TaxId:9606] [53899] (10 PDB entries)
  8. 75526Domain d1bp5d_: 1bp5 D: [35895]

Details for d1bp5d_

PDB Entry: 1bp5 (more details), 2.2 Å

PDB Description: human serum transferrin, recombinant n-terminal lobe, apo form

SCOP Domain Sequences for d1bp5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bp5d_ c.94.1.2 (D:) Transferrin {Human (Homo sapiens)}
ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
kvpprmdakmylgyeyvtairnlregtcpeaptd

SCOP Domain Coordinates for d1bp5d_:

Click to download the PDB-style file with coordinates for d1bp5d_.
(The format of our PDB-style files is described here.)

Timeline for d1bp5d_: