SCOPe 2.08: Domain d6dx7c2: 6dx7 C:241-395

Lineage for d6dx7c2 (6dx7 C:241-395)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.0: automated matches [196908] (1 protein)
not a true family
Protein automated matches [196909] (83 species)
not a true protein
Species Physcomitrella patens [TaxId:3218] [358908] (1 PDB entry)
Domain d6dx7c2: 6dx7 C:241-395 [358918]
automated match to d4yjyb2

Details for d6dx7c2

PDB Entry: 6dx7 (more details), 2.61 Å

PDB Description: crystal structure of chalcone synthase from physcomitrella patens

PDB Compounds: (C:) chalcone synthase

SCOPe Domain Sequences for d6dx7c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dx7c2 c.95.1.0 (C:241-395) automated matches {Physcomitrella patens [TaxId: 3218]}
plfevhwagetilpesdgaidghlteaglifhlmkdvpgliskniekflnearkpvgspa
wnemfwavhpggpaildqveaklkltkdkmqgsrdilsefgnmssasvlfvldqirhrsv
kmgastlgegsefgffigfgpgltlevlvlraapn

SCOPe Domain Coordinates for d6dx7c2:

Click to download the PDB-style file with coordinates for d6dx7c2.
(The format of our PDB-style files is described here.)

Timeline for d6dx7c2: