Lineage for d1d4na_ (1d4n A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1009393Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 1009529Protein Transferrin [53897] (3 species)
  7. 1009530Species Human (Homo sapiens) [TaxId:9606] [53899] (18 PDB entries)
  8. 1009537Domain d1d4na_: 1d4n A: [35891]
    N-terminal lobe
    complexed with co3, fe

Details for d1d4na_

PDB Entry: 1d4n (more details), 2 Å

PDB Description: human serum transferrin
PDB Compounds: (A:) transferrin

SCOPe Domain Sequences for d1d4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4na_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkestifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtc

SCOPe Domain Coordinates for d1d4na_:

Click to download the PDB-style file with coordinates for d1d4na_.
(The format of our PDB-style files is described here.)

Timeline for d1d4na_: