Lineage for d1a8f__ (1a8f -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.2: Transferrin [53888] (3 proteins) Protein Transferrin [53897] (2 species) Species Human (Homo sapiens) [TaxId:9606] [53899] (10 PDB entries) 
Domain d1a8f__: 1a8f - [35890]
Details for d1a8f__
PDB Entry: 1a8f (more details), 1.8 Å
PDB Description: human serum transferrin, recombinant n-terminal lobe
SCOP Domain Sequences for d1a8f__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8f__ c.94.1.2 (-) Transferrin {Human (Homo sapiens)}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtc
SCOP Domain Coordinates for d1a8f__:
Click to download the PDB-style file with coordinates for d1a8f__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a8f__:
- d1a8f__ first appeared (with stable ids) in SCOP 1.55
- d1a8f__ appears in SCOP 1.59
- d1a8f__ appears in the current release, SCOPe 2.08, called d1a8fa_
View in 3D