Lineage for d1d3ka_ (1d3k A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128115Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 128116Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 128300Family c.94.1.2: Transferrin [53888] (3 proteins)
  6. 128371Protein Transferrin [53897] (3 species)
  7. 128372Species Human (Homo sapiens) [TaxId:9606] [53899] (11 PDB entries)
  8. 128374Domain d1d3ka_: 1d3k A: [35889]

Details for d1d3ka_

PDB Entry: 1d3k (more details), 1.8 Å

PDB Description: human serum transferrin

SCOP Domain Sequences for d1d3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3ka_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens)}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvqhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtc

SCOP Domain Coordinates for d1d3ka_:

Click to download the PDB-style file with coordinates for d1d3ka_.
(The format of our PDB-style files is described here.)

Timeline for d1d3ka_: