Lineage for d1a8e__ (1a8e -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28131Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 28132Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 28288Family c.94.1.2: Transferrin [53888] (3 proteins)
  6. 28348Protein Transferrin [53897] (2 species)
  7. 28349Species Human (Homo sapiens) [TaxId:9606] [53899] (8 PDB entries)
  8. 28350Domain d1a8e__: 1a8e - [35888]

Details for d1a8e__

PDB Entry: 1a8e (more details), 1.6 Å

PDB Description: human serum transferrin, recombinant n-terminal lobe

SCOP Domain Sequences for d1a8e__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8e__ c.94.1.2 (-) Transferrin {Human (Homo sapiens)}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtc

SCOP Domain Coordinates for d1a8e__:

Click to download the PDB-style file with coordinates for d1a8e__.
(The format of our PDB-style files is described here.)

Timeline for d1a8e__: