Lineage for d1a8ea_ (1a8e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2914985Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2915097Protein Transferrin [53897] (3 species)
  7. 2915098Species Human (Homo sapiens) [TaxId:9606] [53899] (20 PDB entries)
  8. 2915100Domain d1a8ea_: 1a8e A: [35888]
    N-terminal lobe
    complexed with co3, fe

Details for d1a8ea_

PDB Entry: 1a8e (more details), 1.6 Å

PDB Description: human serum transferrin, recombinant n-terminal lobe
PDB Compounds: (A:) serum transferrin

SCOPe Domain Sequences for d1a8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8ea_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtc

SCOPe Domain Coordinates for d1a8ea_:

Click to download the PDB-style file with coordinates for d1a8ea_.
(The format of our PDB-style files is described here.)

Timeline for d1a8ea_: