Lineage for d1tfd__ (1tfd -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75273Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 75274Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 75451Family c.94.1.2: Transferrin [53888] (3 proteins)
  6. 75515Protein Transferrin [53897] (2 species)
  7. 75531Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53898] (2 PDB entries)
  8. 75534Domain d1tfd__: 1tfd - [35887]

Details for d1tfd__

PDB Entry: 1tfd (more details), 2.3 Å

PDB Description: high-resolution x-ray studies on rabbit serum transferrin: preliminary structure analysis of the n-terminal half-molecule at 2.3 angstroms resolution

SCOP Domain Sequences for d1tfd__:

Sequence, based on SEQRES records: (download)

>d1tfd__ c.94.1.2 (-) Transferrin {Rabbit (Oryctolagus cuniculus)}
vrwcavndheaskcanfrdsmkkvlpedgpriicvkkasyldcikaiaaheadavtldag
lvheagltpnnlkpvvaefygskenpktfyyavalvkkgsnfqlnelqgkkschtglgrs
agwnipigllycdlpeprkplekavasffsgscvpcadgadfpqlcqlcpgcgcsssqpy
fgysgafkclkdglgdvafvkqetifenlpskderdqyellcldntrkpvdeyeqchlar
vpshavvarsvdgkedliwellnqaqehfgkdksgdfqlfssphgknllfkdsaygffk

Sequence, based on observed residues (ATOM records): (download)

>d1tfd__ c.94.1.2 (-) Transferrin {Rabbit (Oryctolagus cuniculus)}
vrwcavndheaskcanfrdsmkkvlpedgpriicvkkasyldcikaiaaheadavtldag
lvheagltpnnlkpvvaefygskenpktfyyavalvkkgsnfqlnelqgkkschtglgrs
agwnipigllycdlpeprkplekavasffsgscvpcadqlcqlcpgcgcsssqpyfgysg
afkclkdglgdvafvkqetifenlpskderdqyellcldntrkpvdeyeqchlarvpsha
vvarsvdgkedliwellnqaqehfgkdksgdfqlfssphgknllfkdsaygffk

SCOP Domain Coordinates for d1tfd__:

Click to download the PDB-style file with coordinates for d1tfd__.
(The format of our PDB-style files is described here.)

Timeline for d1tfd__: