Lineage for d1aiva2 (1aiv A:335-686)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1186196Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 1186307Protein Ovotransferrin [53894] (2 species)
  7. 1186308Species Chicken (Gallus gallus) [TaxId:9031] [53896] (10 PDB entries)
    Uniprot P02789
  8. 1186321Domain d1aiva2: 1aiv A:335-686 [35886]

Details for d1aiva2

PDB Entry: 1aiv (more details), 3 Å

PDB Description: apo ovotransferrin
PDB Compounds: (A:) Ovotransferrin

SCOPe Domain Sequences for d1aiva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aiva2 c.94.1.2 (A:335-686) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]}
qltpsprenriqwcavgkdekskcdrwsvvsngdvectvvdetkdciikimkgeadaval
dgglvytagvcglvpvmaeryddesqcsktderpasyfavavarkdsnvnwnnlkgkksc
htavgrtagwvipmglihnrtgtcnfdeyfsegcapgsppnsrlcqlcqgsggippekcv
asshekyfgytgalrclvekgdvafiqhstveentggknkadwaknlqmddfellctdgr
ranvmdyrecnlaevpthavvvrpekankirdllerqekrfgvngsekskfmmfesqnkd
llfkdltkclfkvregttykeflgdkfytvisslktcnpsdilqmcsflegk

SCOPe Domain Coordinates for d1aiva2:

Click to download the PDB-style file with coordinates for d1aiva2.
(The format of our PDB-style files is described here.)

Timeline for d1aiva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aiva1