Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
Protein automated matches [226868] (6 species) not a true protein |
Species Pinus sylvestris [TaxId:3349] [358851] (1 PDB entry) |
Domain d6dxab1: 6dxa B:3-240 [358852] Other proteins in same PDB: d6dxaa2, d6dxab2 automated match to d1cmla1 complexed with csd |
PDB Entry: 6dxa (more details), 2.01 Å
SCOPe Domain Sequences for d6dxab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dxab1 c.95.1.2 (B:3-240) automated matches {Pinus sylvestris [TaxId: 3349]} agmmkdleafrkaqradgpatilaigtatppnavdqssypdyyfkitnsehmtelkekfr rmcdksaikkrymylteeilkenpkvceymapsldarqdmvvvevprlgkeaaakaikew gqpkskithvifcttsgvdmpgadyqltkllglrpsvkrvmmyqqgcfaggtvlrvakdl aennrgarvlvvcseitavtfrgpsdthldsmvgqalfgdgaaalivgadpvpevekp
Timeline for d6dxab1: