Lineage for d6dxab1 (6dxa B:3-240)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524267Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 2524545Protein automated matches [226868] (6 species)
    not a true protein
  7. 2524587Species Pinus sylvestris [TaxId:3349] [358851] (1 PDB entry)
  8. 2524589Domain d6dxab1: 6dxa B:3-240 [358852]
    Other proteins in same PDB: d6dxaa2, d6dxab2
    automated match to d1cmla1
    complexed with csd

Details for d6dxab1

PDB Entry: 6dxa (more details), 2.01 Å

PDB Description: crystal structure of chalcone synthase from pinus sylvestris
PDB Compounds: (B:) chalcone synthase

SCOPe Domain Sequences for d6dxab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dxab1 c.95.1.2 (B:3-240) automated matches {Pinus sylvestris [TaxId: 3349]}
agmmkdleafrkaqradgpatilaigtatppnavdqssypdyyfkitnsehmtelkekfr
rmcdksaikkrymylteeilkenpkvceymapsldarqdmvvvevprlgkeaaakaikew
gqpkskithvifcttsgvdmpgadyqltkllglrpsvkrvmmyqqgcfaggtvlrvakdl
aennrgarvlvvcseitavtfrgpsdthldsmvgqalfgdgaaalivgadpvpevekp

SCOPe Domain Coordinates for d6dxab1:

Click to download the PDB-style file with coordinates for d6dxab1.
(The format of our PDB-style files is described here.)

Timeline for d6dxab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6dxab2